CPS1 Blocking Peptide

General information

Catalog number

33R-10208

Size

100 µg

Price

210.00 €

Detailed information

Category

Proteins

Antibody Subtype

Blocking Peptides

Area of research

Cell Biology

Residues

YPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCGPYHIGSSVEFDWCAVSSI

Type of protein

Synthetic

Form & Buffer

Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage

Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

Shipping conditions

Blue Ice

Tested for

WB; IHC

Test

You can block the antibody by the specific target amino acid sequence of peptide.

Properties

blocking peptide

Description

Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.